PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g014413m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 426aa    MW: 47785.9 Da    PI: 6.1421
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g014413mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4685.2e-143244211373
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lLl+cA++v++g+le+a+ +L ++s+laspdgd+mqR+aayfteALa+r+++s+++l kal++++ s  ++see+ ++klf++++P+lk
  orange1.1g014413m  24 LIHLLLSCANHVANGSLENANLALDQISQLASPDGDTMQRIAAYFTEALAQRILKSWPGLHKALNSTRIS--SVSEEMLVRKLFFDMFPFLK 113
                        689*************************************************************999987..59****************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvak 184
                        ++++++NqaI ea+ege+ vH+iD+++ +++QW+aL+qaL++Rpegpp+lRiTg+++    +ke l ++++rL++ Ae+l++pf+fn  v++
  orange1.1g014413m 114 VAFVLTNQAIIEAMEGEKVVHVIDLNAAEPAQWIALIQALSTRPEGPPHLRITGIHP----QKEVLDQMAHRLTEEAEKLDIPFQFNS-VVS 200
                        *********************************************************....9**************************.799 PP

               GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrll....................................desvsleserdevLklvkslsPkvvv 240
                        +le+l++++Lrvk+gEala+++vlqlh+ll                                    +     + + d++L+ +++lsPkv+v
  orange1.1g014413m 201 KLENLDFDKLRVKTGEALAISSVLQLHSLLaaddyaslialknsllangygysqspdsvsssplspN----ASAKMDSFLNSLWGLSPKVMV 288
                        **********************************************************997653222....2225788************** PP

               GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsek 332
                        v+eq+++hn+ +++er+leal+ y+alfd+le++++r+s er kvE++l+g+ei+n++aceg+er+erhe+lekW +r++ a F++vpls+ 
  orange1.1g014413m 289 VTEQDSNHNGLTLMERLLEALYSYAALFDCLESSVSRTSMERLKVEKMLFGEEIKNIIACEGFERKERHEKLEKWIQRFDLACFGNVPLSYC 380
                        ******************************************************************************************** PP

               GRAS 333 aakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                         + qa++ll+ ++ dgyr+ e++ +++++W+drpL+svSaW
  orange1.1g014413m 381 GMLQARRLLQSYNCDGYRIAEDNRCVLICWHDRPLFSVSAW 421
                        ***************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.7281402IPR005202Transcription factor GRAS
PfamPF035141.8E-14024421IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 426 aa     Download sequence    Send to blast
MSPSLGSPYQ WLRELKSEER GLYLIHLLLS CANHVANGSL ENANLALDQI SQLASPDGDT  60
MQRIAAYFTE ALAQRILKSW PGLHKALNST RISSVSEEML VRKLFFDMFP FLKVAFVLTN  120
QAIIEAMEGE KVVHVIDLNA AEPAQWIALI QALSTRPEGP PHLRITGIHP QKEVLDQMAH  180
RLTEEAEKLD IPFQFNSVVS KLENLDFDKL RVKTGEALAI SSVLQLHSLL AADDYASLIA  240
LKNSLLANGY GYSQSPDSVS SSPLSPNASA KMDSFLNSLW GLSPKVMVVT EQDSNHNGLT  300
LMERLLEALY SYAALFDCLE SSVSRTSMER LKVEKMLFGE EIKNIIACEG FERKERHEKL  360
EKWIQRFDLA CFGNVPLSYC GMLQARRLLQ SYNCDGYRIA EDNRCVLICW HDRPLFSVSA  420
WSCRK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-43244214374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.31290.0callus| flower| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006446239.10.0hypothetical protein CICLE_v10015219mg
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLV4W0V10.0V4W0V1_9R
STRINGPOPTR_0009s05330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40982759
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3